BYKdb

Annotate results for A0A173KYL4

A0A173KYL4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A173KYL4
DOMAINtad1/167MARAGWTAVWRNRIILFVTMALCVLAGIVFILLSTPDYRATASVEVEDVPAGAAGAGATQ
RQLTAADNESLMQTELEVLRSRALAEDVARELALVGSRTFFDGMDERRPDRGSTMLNQRQ
VETEAVIRLLRDNLDVELPGKSRVIRISFTSADPVLSARVANSYADS
DOMAINcd499/678TSAQEGEGKSSTVHALALALAKLDRRVLVIDADMRRPRQHGLFHVTPERGISEVMTGQAK
AEDVIVDSGAPGVSLLPSGAIPPNPAELLSTPALDVLLASVQGHYDTVLIDAPPILGVPD
TSLLAAKVQAAVLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAVLTKQQGRAFEYDYRRGG
SITEWalker A506/508GKS
SITEWalker A'526/533LVIDADMR
SITEWalker B606/612VLIDAPP
SITEY Cluster672/674YDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARAGWTAVWRNRIILFVTMALCVLAGIVFILLSTPDYRATASVEVEDVPAGAAGAGATQRQLTAADNESLMQTELEVLR
MARAGWTAVWRNRIILFVTMALCVLAGIVFILLSTPDYRATASVEVEDVPAGAAGAGATQRQLTAADNESLMQTELEVLR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRALAEDVARELALVGSRTFFDGMDERRPDRGSTMLNQRQVETEAVIRLLRDNLDVELPGKSRVIRISFTSADPVLSARV
SRALAEDVARELALVGSRTFFDGMDERRPDRGSTMLNQRQVETEAVIRLLRDNLDVELPGKSRVIRISFTSADPVLSARV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANSYADSLIRADLKRGFESGVQARRFLLGELDGARRDLEHAERDLAAYATQTGASAGAALAARGDGTAGAEGTTTTRLAQ
ANSYADS                                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNAFRAQAIADRIAVQKRWESARLSSVETLPEVLNNGGMQQLMAQRAQARAEVVEERQFRKDAHPEMREARARLAALDDQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAMANTIRASLREQYEVAVHGEKQIEAEIAGVERQAQAERGRGVQMSILERSVDTYRLLHDSLLQRYRDMASQAGFQAG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIQPLDRAAVPTRPSSPRIGVTMLLASLGGLVLGLLMVAGRHVFDDAVTSADTLAERANLPLLGTVPVTDKPAAETFVPI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASSLLLASSEGLPASILVTSAQEGEGKSSTVHALALALAKLDRRVLVIDADMRRPRQHGLFHVTPERGISEVMTGQAKAE
                  TSAQEGEGKSSTVHALALALAKLDRRVLVIDADMRRPRQHGLFHVTPERGISEVMTGQAKAE
                         GKS                 LVIDADMR                           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVIVDSGAPGVSLLPSGAIPPNPAELLSTPALDVLLASVQGHYDTVLIDAPPILGVPDTSLLAAKVQAAVLVVEWGRNHH
DVIVDSGAPGVSLLPSGAIPPNPAELLSTPALDVLLASVQGHYDTVLIDAPPILGVPDTSLLAAKVQAAVLVVEWGRNHH
                                             VLIDAPP                            
       650       660       670        
....:....|....:....|....:....|....:...
GGLRVAVDRLRRAGGAIIGAVLTKQQGRAFEYDYRRGG
GGLRVAVDRLRRAGGAIIGAVLTKQQGRAFEYDYRRGG
                               YDY    
© 1998-2019