BYKdb

Annotate results for A0A173MW79

A0A173MW79 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A173MW79
DOMAINtad8/258DEIDLRALIAVLLNHWKLILSMLLLGLLGGLYYAQSATPIYKTNSLIQVDKKSSGVSALG
ADVADLLNAQDGSAQTEVEIINSRMILWPVINQLHLDLNVNQLKDSFLDKLLIKKSVLVS
HTDNGVGNLKEGLWIVEFNVPLAYQNKNFVLTAIDSQDFKLISPDGAEFTGKVATASRFK
TSAGNIDIQVTSLAPGYSYNLSKLTPAKAIDNLRANLAVAEKGKQTGILDASLTGANQDE
ITNTLTRIVKM
DOMAINcd532/722TSAGPGVGKSFIAANLAVAMAMTGKRVLLIDADTRLGHLQDRFNLPNINGLVDYLVDDTI
DAANSSYMIQTTLYENLHFIPRGKGHSHASELFLGKKMKALLNFYRQFYDYVIIDTSPVL
GTSDALSIGQLVDSVLFVVRYDVSNVKQVNYAIEKLQRANVKVEGIIFNDAKQSLIGAYN
YHYGYEYKSKN
SITEWalker A539/541GKS
SITEWalker A'559/566LLIDADTR
SITEWalker B643/649VIIDTSP
SITE-636/-642YRQFYDY
SITEY Cluster710/718YNYHYGYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDQKVNDDEIDLRALIAVLLNHWKLILSMLLLGLLGGLYYAQSATPIYKTNSLIQVDKKSSGVSALGADVADLLNAQDGS
       DEIDLRALIAVLLNHWKLILSMLLLGLLGGLYYAQSATPIYKTNSLIQVDKKSSGVSALGADVADLLNAQDGS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQTEVEIINSRMILWPVINQLHLDLNVNQLKDSFLDKLLIKKSVLVSHTDNGVGNLKEGLWIVEFNVPLAYQNKNFVLTA
AQTEVEIINSRMILWPVINQLHLDLNVNQLKDSFLDKLLIKKSVLVSHTDNGVGNLKEGLWIVEFNVPLAYQNKNFVLTA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDSQDFKLISPDGAEFTGKVATASRFKTSAGNIDIQVTSLAPGYSYNLSKLTPAKAIDNLRANLAVAEKGKQTGILDASL
IDSQDFKLISPDGAEFTGKVATASRFKTSAGNIDIQVTSLAPGYSYNLSKLTPAKAIDNLRANLAVAEKGKQTGILDASL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGANQDEITNTLTRIVKMYETQNLDKSSAETTKTLEFMQEQLPKLKAKLAEAEAKFNNFREQNATVDIDKEAELAVTQRA
TGANQDEITNTLTRIVKM                                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIETNLRELELKRAELSERYTDEYPVLKQLNMQIQELKDKEEALKQNITRIPEVQRQFLELSSDVKISNEIYLNMLKNYE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLQIVKSGQLGNVRIIDLPINTYEPIAPKKAQIVLIATLLGLMLGIGLAFLKSLLFAGVKNLEELENNTDIPVIGVIPHS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRLTRLLKSKSTKIPLVEQIEPEGIVSEGFKSIRTHLLFNATKTDGNTYLVTSAGPGVGKSFIAANLAVAMAMTGKRVLL
                                                   TSAGPGVGKSFIAANLAVAMAMTGKRVLL
                                                          GKS                 LL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADTRLGHLQDRFNLPNINGLVDYLVDDTIDAANSSYMIQTTLYENLHFIPRGKGHSHASELFLGKKMKALLNFYRQFY
IDADTRLGHLQDRFNLPNINGLVDYLVDDTIDAANSSYMIQTTLYENLHFIPRGKGHSHASELFLGKKMKALLNFYRQFY
IDADTR                                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYVIIDTSPVLGTSDALSIGQLVDSVLFVVRYDVSNVKQVNYAIEKLQRANVKVEGIIFNDAKQSLIGAYNYHYGYEYKS
DYVIIDTSPVLGTSDALSIGQLVDSVLFVVRYDVSNVKQVNYAIEKLQRANVKVEGIIFNDAKQSLIGAYNYHYGYEYKS
  VIIDTSP                                                            YNYHYGYEY  
  
..
KN
KN

© 1998-2019