BYKdb

Annotate results for A0A173RVC7

A0A173RVC7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A173RVC7
DOMAINcd39/227TSTMPSEGKSTVSLELARSFAALGKNTVLMDCDMRKSYLVRRLGIQEKIQGVSEYLSKQS
MKIVYRTSDPNLSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDG
AIISRQVDGTLLVVRNDFVKTKAVKKVKQQIEQNGGRVLGVALNRIKKNQKGAYPYGKKY
YSYEYKKEK
SITEWalker A46/48GKS
SITEWalker A'66/73VLMDCDMR
SITEWalker B145/151IIVDAPP
SITE-142/-144YDY
SITEY Cluster212/223YPYGKKYYSYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQAKIVLPNEELEYGAAEAIKTLRTNIMYSEDVKAIMLTSTMPSEGKSTVSLELARSFAALGKNTVLMDCDMRKSYLVRR
                                      TSTMPSEGKSTVSLELARSFAALGKNTVLMDCDMRKSYLVRR
                                             GKS                 VLMDCDMR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGIQEKIQGVSEYLSKQSMKIVYRTSDPNLSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDGAI
LGIQEKIQGVSEYLSKQSMKIVYRTSDPNLSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDGAI
                                                                IIVDAPP         
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
ISRQVDGTLLVVRNDFVKTKAVKKVKQQIEQNGGRVLGVALNRIKKNQKGAYPYGKKYYSYEYKKEK
ISRQVDGTLLVVRNDFVKTKAVKKVKQQIEQNGGRVLGVALNRIKKNQKGAYPYGKKYYSYEYKKEK
                                                   YPYGKKYYSYEY    
© 1998-2019