BYKdb

Annotate results for A0A173T2J7

A0A173T2J7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A173T2J7
DOMAINcd41/226TSPGASEGKSTTSANLGMTFSQTGKKTLLVDCDLRCPRLHQLFELPNVKGLSQVLCLKES
LDEMKQSINEHLDVLTTGPLPPNPVEFLNSKGMQTFIKEVREQYDRIIFDTPPVGILTDA
AIVGAHTDGTLLVVATGKSDIELTLKSKENLNNVKANLLGVVMTMMPIQSKQYYHYYHSY
GLDVKK
SITE-177/-179GKS
SITEWalker A'68/75LLVDCDLR
SITEWalker B147/153IIFDTPP
SITEY Cluster213/220YYHYYHSY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDNALITVHQPKSPITEAYRTLETNLNFSSLDREMKTLTITSPGASEGKSTTSANLGMTFSQTGKKTLLVDCDLRCPRLH
                                        TSPGASEGKSTTSANLGMTFSQTGKKTLLVDCDLRCPRLH
                                               GKS                 LLVDCDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLFELPNVKGLSQVLCLKESLDEMKQSINEHLDVLTTGPLPPNPVEFLNSKGMQTFIKEVREQYDRIIFDTPPVGILTDA
QLFELPNVKGLSQVLCLKESLDEMKQSINEHLDVLTTGPLPPNPVEFLNSKGMQTFIKEVREQYDRIIFDTPPVGILTDA
                                                                  IIFDTPP       
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
AIVGAHTDGTLLVVATGKSDIELTLKSKENLNNVKANLLGVVMTMMPIQSKQYYHYYHSYGLDVKKPKRRFGFRKAKA
AIVGAHTDGTLLVVATGKSDIELTLKSKENLNNVKANLLGVVMTMMPIQSKQYYHYYHSYGLDVKK            
                                                    YYHYYHSY                  
© 1998-2019