BYKdb

Annotate results for A0A173TLV7

A0A173TLV7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A173TLV7
DOMAINcd40/236TSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAGRLRATAASGGEICGLSHYL
SGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPI
GAAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHV
SGYYGNYYGSYYGRSDK
SITEWalker A47/49GKS
SITEWalker A'67/74LFIDTDMR
SITEWalker B152/158IIIDCAP
SITEY Cluster222/231YYGNYYGSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
                                       TSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
                                              GKS                 LFIDTDMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
                                                                       IIIDCAP  
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDKA
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDK 
                                                             YYGNYYGSYY      
© 1998-2019