BYKdb

Annotate results for A0A173UW43

A0A173UW43 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A173UW43
DOMAINtad14/151NLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITS
ENSNSYIENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKV
TANNPKMAEKILKAVVKN
DOMAINcd283/470TSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPSTAKVLGMNEQELGTLEVMKGEV
NIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGLLS
DAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMN
SYRTKGET
SITEWalker A290/292GKS
SITEWalker A'310/317ILVDADLR
SITEWalker B391/397VIIDTPP
SITEY Cluster460/464YMNSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNSYI
             NLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNSYI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKN         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPRAKFHKKRT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
                                          TSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
                                                 GKS                 ILVDADLR   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGL
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGL
                                                                      VIIDTPP   
       410       420       430       440       450       460       470 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGET 
                                                           YMNSY       
© 1998-2019