BYKdb

Annotate results for A0A173V3I7

A0A173V3I7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A173V3I7
DOMAINcd40/232TSCMENDGKSSVSFNLAKILAENDKRVLFIDADMRNSVLMNRTGIPDDLKGLSHYLAGKN
AASEVIYATNYKNFYVIPTGRFPKNPTELLNKPAYEVLIEGMKQTFDYVIIDTPPLGSVV
DAALIAKTADASVLVISANAVSRRMANSVKEQLINANPNFLGVILNKADEGTKHYGYGKR
YGSKYGYGYGYGR
SITEWalker A47/49GKS
SITEWalker A'67/74LFIDADMR
SITEWalker B148/154VIIDTPP
SITE-106/-114YATNYKNFY
SITEY Cluster214/233YGYGKRYGSKYGYGYGYGRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQELILEEKTTLSPVMKEIYRRLRTNLEFTGIENKVICLTSCMENDGKSSVSFNLAKILAENDKRVLFIDADMRNSVLMN
                                       TSCMENDGKSSVSFNLAKILAENDKRVLFIDADMRNSVLMN
                                              GKS                 LFIDADMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTGIPDDLKGLSHYLAGKNAASEVIYATNYKNFYVIPTGRFPKNPTELLNKPAYEVLIEGMKQTFDYVIIDTPPLGSVVD
RTGIPDDLKGLSHYLAGKNAASEVIYATNYKNFYVIPTGRFPKNPTELLNKPAYEVLIEGMKQTFDYVIIDTPPLGSVVD
                                                                   VIIDTPP      
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
AALIAKTADASVLVISANAVSRRMANSVKEQLINANPNFLGVILNKADEGTKHYGYGKRYGSKYGYGYGYGRYGQNPKE
AALIAKTADASVLVISANAVSRRMANSVKEQLINANPNFLGVILNKADEGTKHYGYGKRYGSKYGYGYGYGR       
                                                     YGYGKRYGSKYGYGYGYGRY      
© 1998-2019