BYKdb

Annotate results for A0A173WD57

A0A173WD57 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A173WD57
DOMAINcd39/232TSCTPNEGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGRTEVEGEEIKGLSHLLSHQ
ETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSV
IDSAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKY
YGKYYGKYGDKKTE
SITEWalker A46/48GKS
SITEWalker A'66/73LFIDADLR
SITEWalker B148/154VIIDTPP
SITE-145/-147YDY
SITEY Cluster214/226YYGKYYGKYYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKEVNIYRQELDYSANESYKSLRTNLLFCGEDKKVIAVTSCTPNEGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGR
                                      TSCTPNEGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGR
                                             GKS                 LFIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEVEGEEIKGLSHLLSHQETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSVID
TEVEGEEIKGLSHLLSHQETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSVID
                                                                   VIIDTPP      
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
SAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKYYGKYYGKYGDKKTEKK
SAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKYYGKYYGKYGDKKTE  
                                                     YYGKYYGKYYGKY        
© 1998-2019