BYKdb

Annotate results for A0A173XUJ1

A0A173XUJ1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A173XUJ1
DOMAINcd52/240VSTDMNEGKTLNSINIATSFAMAGKRTLLIDCDMRNPAVHCYLRLSEVSGLSEILARIEK
KINIVHTEQENLFVLKAGVVPPNPSELLGGRLFGELIAQFRKRFDYIILDMPPVGVVADA
AIVSSYVDGYVFVVRTMYKDLGEIRKAMEMLQSVQGKIAGFVLNDVEGKNDTDHTYGKYG
YDYGSRNNE
SITEWalker A59/61GKT
SITEWalker A'79/86LLIDCDMR
SITEWalker B158/164IILDMPP
SITE-177/-181YVDGY
SITEY Cluster227/234YGKYGYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVKSKKKESSFKTYKKILGKDSSFKLKEAYSKIRTKLMFTENEDGGTVYAVVSTDMNEGKTLNSINIATSFAMAGKRTLL
                                                   VSTDMNEGKTLNSINIATSFAMAGKRTLL
                                                          GKT                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDCDMRNPAVHCYLRLSEVSGLSEILARIEKKINIVHTEQENLFVLKAGVVPPNPSELLGGRLFGELIAQFRKRFDYIIL
IDCDMRNPAVHCYLRLSEVSGLSEILARIEKKINIVHTEQENLFVLKAGVVPPNPSELLGGRLFGELIAQFRKRFDYIIL
IDCDMR                                                                       IIL
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMPPVGVVADAAIVSSYVDGYVFVVRTMYKDLGEIRKAMEMLQSVQGKIAGFVLNDVEGKNDTDHTYGKYGYDYGSRNNE
DMPPVGVVADAAIVSSYVDGYVFVVRTMYKDLGEIRKAMEMLQSVQGKIAGFVLNDVEGKNDTDHTYGKYGYDYGSRNNE
DMPP                                                              YGKYGYDY      
© 1998-2019