BYKdb

Annotate results for A0A173Y3J1

A0A173Y3J1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A173Y3J1
DOMAINcd283/472TSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPSTAKVLGMQEQELGTLQVLKGEV
KIEDAVQPYKDTSVMVLAGSSPIQDTSTVLSGENMRQFIKELEAKADFVVIDTPPSAMLS
DAAIVAQYVDGAVFVIRQDYTEADRILEGMEILSSSGAQITGCILNDANVKGNSSQHYKN
SYRLKGEVKV
SITEWalker A290/292GKS
SITEWalker A'310/317ILVDADLR
SITEWalker B391/397VVIDTPP
SITEY Cluster460/464YKNSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKDYAEHRENRENLIDIAGLFDDLVKVAFQLKFKFLITIIVCGVIFCGYKRFTYSPYYIASSTFTISSSISSENSNTYI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENATANQMAKSFPYILQSGAFKQVLAEDLGMQSVPGTIEAEVMENTNLFTLKVTESSPELAQKVLESVVKNYPSVAEFVI


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSSQLTLMDESGVPTAPANPFSYKHELEIGAAIGILLCVFLDVLLALGKNTVKKEEDFKRLFHVDSLGVLPHAKFHKKRT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVEELIVLDNPRLPRSFLEASRTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
                                          TSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
                                                 GKS                 ILVDADLR   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAKVLGMQEQELGTLQVLKGEVKIEDAVQPYKDTSVMVLAGSSPIQDTSTVLSGENMRQFIKELEAKADFVVIDTPPSAM
TAKVLGMQEQELGTLQVLKGEVKIEDAVQPYKDTSVMVLAGSSPIQDTSTVLSGENMRQFIKELEAKADFVVIDTPPSAM
                                                                      VVIDTPP   
       410       420       430       440       450       460       470  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
LSDAAIVAQYVDGAVFVIRQDYTEADRILEGMEILSSSGAQITGCILNDANVKGNSSQHYKNSYRLKGEVKV
LSDAAIVAQYVDGAVFVIRQDYTEADRILEGMEILSSSGAQITGCILNDANVKGNSSQHYKNSYRLKGEVKV
                                                           YKNSY        
© 1998-2019