BYKdb

Annotate results for A0A173Y645

A0A173Y645 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A173Y645
DOMAINtad15/146MNIDLYSILRDISKYIVVILLLAASMSLLAYVYVGRSYHKQYESTSTFIVSSKGSNNSVY
SDLSTTTEMATKFSEILNSSILQKKVAKEMNMDYFPGTASAEVVNETNLLVLKVQADSPE
MAFSLNKAIMNN
DOMAINcd282/473ASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQYKIFGLAPEEVQEFGEVLNGN
EKSDHLVHALAKSELLLVTGTMIYPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQA
ADAEELVDYADASILVVRQHTALVKDINEAISILNSGEGTMLGCVYNDVFHGIAQTARNY
GYRYAYGSGSSY
SITEWalker A289/291GKS
SITEWalker A'309/316LLIDADLR
SITEWalker B391/397VIIDTPP
SITEY Cluster461/479YGYRYAYGSGSSYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNEKHNISVNDYEMNIDLYSILRDISKYIVVILLLAASMSLLAYVYVGRSYHKQYESTSTFIVSSKGSNNSVYSDLSTT
              MNIDLYSILRDISKYIVVILLLAASMSLLAYVYVGRSYHKQYESTSTFIVSSKGSNNSVYSDLSTT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEMATKFSEILNSSILQKKVAKEMNMDYFPGTASAEVVNETNLLVLKVQADSPEMAFSLNKAIMNNYSVVTNRLIGTVVL
TEMATKFSEILNSSILQKKVAKEMNMDYFPGTASAEVVNETNLLVLKVQADSPEMAFSLNKAIMNN              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVLQNPTVPSGPVNEFQPAALMKKTFVMTIVALCGLIAIISFLKDTVRKPKEVSKKLDGTLLQTLYHERLYKSWKARIHR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKSSVLLTNPGTSFQYVEDMKKLARKVSSKMKDKQAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
                                         ASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
                                                GKS                 LLIDADLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKIFGLAPEEVQEFGEVLNGNEKSDHLVHALAKSELLLVTGTMIYPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
YKIFGLAPEEVQEFGEVLNGNEKSDHLVHALAKSELLLVTGTMIYPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
                                                                      VIIDTPP   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AADAEELVDYADASILVVRQHTALVKDINEAISILNSGEGTMLGCVYNDVFHGIAQTARNYGYRYAYGSGSSYGYGYGYG
AADAEELVDYADASILVVRQHTALVKDINEAISILNSGEGTMLGCVYNDVFHGIAQTARNYGYRYAYGSGSSY       
                                                            YGYRYAYGSGSSYGYGYGY 
       490       500       510       520      
....:....|....:....|....:....|....:....|....:.
NKYGYGGKYGYGYGYGRSSRQSKQEEQKEQHNKDSVTERQVKKEDE


© 1998-2019