BYKdb

Annotate results for A0A173ZYY6

A0A173ZYY6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A173ZYY6
DOMAINtad15/145NDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVSSRGDANAYS
NLSSANTMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKD
SIDIIRTVMDN
DOMAINcd281/476TSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQFLIFGMEPKEENELGEYLRGN
GSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSESFFKLMAACRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVSKQNYMLAEDINEVMDDFRDKEGKVLGVVLNGVRSFSGLVDSPV
GHYYGKYSKYGRYGNY
SITEWalker A288/290GKS
SITEWalker A'308/315LLVDGDIR
SITEWalker B390/396VIIDTPP
SITEY Cluster463/476YYGKYSKYGRYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MESSNRNDMPVFMDNDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVSSRGDANAYSNLSSAN
              NDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVSSRGDANAYSNLSSAN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKDSIDIIRTVMDNYSSVSLYTVGSAVMD
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKDSIDIIRTVMDN               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLEEPKVPYTPDNPLDAGGQAKKGGLVAGALVIILLGLFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
                                        TSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
                                               GKS                 LLVDGDIR     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIFGMEPKEENELGEYLRGNGSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSESFFKLMAACRKFVDYVIIDTPPAGII
LIFGMEPKEENELGEYLRGNGSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSESFFKLMAACRKFVDYVIIDTPPAGII
                                                                     VIIDTPP    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDAQIFAHCADAVMIVSKQNYMLAEDINEVMDDFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GDAQIFAHCADAVMIVSKQNYMLAEDINEVMDDFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNY    
                                                              YYGKYSKYGRYGNY    
  
..
GM


© 1998-2019