BYKdb

Annotate results for A0A174A3G1

A0A174A3G1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174A3G1
DOMAINtad30/169DGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASDGGESI
AQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNI
AVVDGDPKQAADIANSVAES
DOMAINcd302/491TSAQPSEGKTTMAINTAVALAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMG
PKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVEQALTQYDYVIIDTAPLTVSND
GAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYY
YYEDGAPRSS
SITEWalker A309/311GKT
SITEWalker A'329/336LLIDADLR
SITEWalker B409/415VIIDTAP
SITE-406/-408YDY
SITEY Cluster479/483YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
                             DGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NASDGGESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
NASDGGESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
DIANSVAES                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
                                                             TSAQPSEGKTTMAINTAVA
                                                                    GKT         
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVE
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVE
        LLIDADLR                                                                
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYY
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYY
        VIIDTAP                                                               YY
       490       500
....:....|....:....|
YYYEDGAPRSSHRAKGKKRH
YYYEDGAPRSS         
YYY                 
© 1998-2019