BYKdb

Annotate results for A0A174AMP7

A0A174AMP7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174AMP7
DOMAINcd42/231TSCYPNEGKSDITFQLSQEIGKLGKKVLLLDADIRKSILASRYGVGKQVQGLSNYLSGQA
SIAEIIYRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSII
DAAIVAKQCDGAVLVFESELVSSKEAARVKEQLLMTGCRLIGAVLNKVDVKKNKYYHRYD
YYYHGYQEKK
SITEWalker A49/51GKS
SITEWalker A'69/76LLLDADIR
SITEWalker B150/156IIVDTPP
SITE-108/-149YRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDY
SITEY Cluster216/227YYHRYDYYYHGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEQKVIMTDPRQEDYFYQEAIKTLRTNIQFAGMDVKTILFTSCYPNEGKSDITFQLSQEIGKLGKKVLLLDADIRKSIL
                                         TSCYPNEGKSDITFQLSQEIGKLGKKVLLLDADIRKSIL
                                                GKS                 LLLDADIR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASRYGVGKQVQGLSNYLSGQASIAEIIYRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSI
ASRYGVGKQVQGLSNYLSGQASIAEIIYRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSI
                                                                     IIVDTPP    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDAAIVAKQCDGAVLVFESELVSSKEAARVKEQLLMTGCRLIGAVLNKVDVKKNKYYHRYDYYYHGYQEKKEVTKKNKEK
IDAAIVAKQCDGAVLVFESELVSSKEAARVKEQLLMTGCRLIGAVLNKVDVKKNKYYHRYDYYYHGYQEKK         
                                                       YYHRYDYYYHGY             
© 1998-2019