BYKdb

Annotate results for A0A174B337

A0A174B337 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174B337
DOMAINcd40/231TSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAGRLGVEEEVKGLSQLLSGQV
GLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVI
DAAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYY
KHYGEYYRRSDE
SITEWalker A47/49GKS
SITEWalker A'67/74LLLDADIR
SITEWalker B148/154ILIDTPP
SITE-144/-147YYNY
SITEY Cluster214/226YYSSYYKHYGEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
                                       TSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
                                              GKS                 LLLDADIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
                                                                   ILIDTPP      
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYRRSDEEAQIK
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYRRSDE     
                                                     YYSSYYKHYGEYY          
© 1998-2019