BYKdb

Annotate results for A0A174B9F5

A0A174B9F5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174B9F5
DOMAINtad24/164DGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYSDSSVQDNN
ISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTNTAFVN
ITAETGDAKQASDIANSVAES
DOMAINcd297/486SSVGPSEGKTTVSVNVAAALAENGAKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQAT
VKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLDAALQTYDYVIIDTSPMVVAND
ATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYYY
YYYYDEDGKK
SITEWalker A304/306GKT
SITEWalker A'324/331LLIDADLR
SITEWalker B404/410VIIDTSP
SITE-401/-403YDY
SITEY Cluster474/480YYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYSDSSVQ
                       DGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYSDSSVQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTNTAFVNITAETGDAKQASDIANS
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTNTAFVNITAETGDAKQASDIANS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAESLSNVVEKSLYASGKESPVKLSVVQRAAEPISPSSPKVALYLAVGLVAGLILGVFATLIRDLMATRVEEASDLQDII
VAES                                                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAPIMGRIPTDESLQSNKPIIVSNPAGRIAEEFRRIRTNLSFTSKVEGSDARMIVISSVGPSEGKTTVSVNVAAALAENG
                                                        SSVGPSEGKTTVSVNVAAALAENG
                                                               GKT              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQATVKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLDAALQT
AKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQATVKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLDAALQT
   LLIDADLR                                                                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDYVIIDTSPMVVANDATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYYYYYYY
YDYVIIDTSPMVVANDATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYYYYYYY
   VIIDTSP                                                               YYYYYYY
       490       500 
....:....|....:....|.
DEDGKKSKHAHKNSRKKSKHN
DEDGKK               

© 1998-2019