BYKdb

Annotate results for A0A174BC88

A0A174BC88 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174BC88
DOMAINcd40/230TSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAARYHIQGIDKGLSHYLTGQA
EVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVI
DAVIIGKYTDGAVIVIEQGMIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEY
KYSYYGESDTE
SITEWalker A47/49GKS
SITEWalker A'67/74LMVDADLR
SITEWalker B148/154VIIDAPP
SITEY Cluster214/224YGNYEYKYSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
                                       TSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
                                              GKS                 LMVDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
                                                                   VIIDAPP      
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
AVIIGKYTDGAVIVIEQGMIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYYGESDTEKNHPNT
AVIIGKYTDGAVIVIEQGMIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYYGESDTE      
                                                     YGNYEYKYSYY            
© 1998-2019