BYKdb

Annotate results for A0A174CVN6

A0A174CVN6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174CVN6
DOMAINcd40/229TSTVPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMGHYRVDRETRGLSHYLVGQE
SAENVTYNTNIENMEVIFAGPSTPNPAELLGNVRFEEMLGEQRGNYDYILIDTPPLGSVI
DAAIIARNVDGAVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVDQENKGYYSGYY
SKYYGKYYGY
SITEWalker A47/49GKT
SITEWalker A'67/74LLLDADMR
SITEWalker B148/154ILIDTPP
SITE-145/-147YDY
SITEY Cluster214/229YYSGYYSKYYGKYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKVEFKKIPQLDFRTNEAFKTLRTNITFCGDDQRVILFTSTVPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
                                       TSTVPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
                                              GKT                 LLLDADMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HYRVDRETRGLSHYLVGQESAENVTYNTNIENMEVIFAGPSTPNPAELLGNVRFEEMLGEQRGNYDYILIDTPPLGSVID
HYRVDRETRGLSHYLVGQESAENVTYNTNIENMEVIFAGPSTPNPAELLGNVRFEEMLGEQRGNYDYILIDTPPLGSVID
                                                                   ILIDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIIARNVDGAVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVDQENKGYYSGYYSKYYGKYYGYGASGSSDKAEK
AAIIARNVDGAVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVDQENKGYYSGYYSKYYGKYYGY           
                                                     YYSGYYSKYYGKYYGY           
       250       260      
....:....|....:....|....:.
SEQNTEVNTVSVSSEEKQAKRSRRRK


© 1998-2019