BYKdb

Annotate results for A0A174DL89

A0A174DL89 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174DL89
DOMAINtad1/140MNKFKYFKLIKEKLSIIILITISSIIISTIATLFFIEPTYESKISVIIGPNQSTSGDYSS
SQSSYDVVMYQKMVKTYSELLTSKIVLQDVIENTGLDLNLESLESMIKIKTTTESEFINI
TVEGKVPEVTTLVANQLTLS
DOMAINcd269/446TSSSPSEGKSTIISNLGISMALTNKKVIIIDCDMRKPKIHRIFSLSNIIGLSHILSNQAE
LEECLQSSGINNLSILTAGVIPPNPSELISSNGMKILLDRLTSNFDFILIDSPPLPLVAD
SQALSTFVDGTIIITKLGYTTKSALLNTKEILDGLKTNVIGVVLNNSPLDSSVNYYYQ
SITEWalker A276/278GKS
SITEWalker A'296/303IIIDCDMR
SITEWalker B376/382ILIDSPP
SITEY Cluster443/445YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKFKYFKLIKEKLSIIILITISSIIISTIATLFFIEPTYESKISVIIGPNQSTSGDYSSSQSSYDVVMYQKMVKTYSEL
MNKFKYFKLIKEKLSIIILITISSIIISTIATLFFIEPTYESKISVIIGPNQSTSGDYSSSQSSYDVVMYQKMVKTYSEL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTSKIVLQDVIENTGLDLNLESLESMIKIKTTTESEFINITVEGKVPEVTTLVANQLTLSLKNISSEIRGVDNVILVDSA
LTSKIVLQDVIENTGLDLNLESLESMIKIKTTTESEFINITVEGKVPEVTTLVANQLTLS                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIPEKPTKPNIIINISLSFILGLIFSISLVVLINYLDQRIKDKDELKELITFPILGEIPDFSSVNINNKGNYLFVNESPK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLPSEAINILRTNLQFCNVNYNLKKILITSSSPSEGKSTIISNLGISMALTNKKVIIIDCDMRKPKIHRIFSLSNIIGLS
                            TSSSPSEGKSTIISNLGISMALTNKKVIIIDCDMRKPKIHRIFSLSNIIGLS
                                   GKS                 IIIDCDMR                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HILSNQAELEECLQSSGINNLSILTAGVIPPNPSELISSNGMKILLDRLTSNFDFILIDSPPLPLVADSQALSTFVDGTI
HILSNQAELEECLQSSGINNLSILTAGVIPPNPSELISSNGMKILLDRLTSNFDFILIDSPPLPLVADSQALSTFVDGTI
                                                       ILIDSPP                  
       410       420       430       440      
....:....|....:....|....:....|....:....|....:.
IITKLGYTTKSALLNTKEILDGLKTNVIGVVLNNSPLDSSVNYYYQ
IITKLGYTTKSALLNTKEILDGLKTNVIGVVLNNSPLDSSVNYYYQ
                                          YYY 
© 1998-2019