BYKdb

Annotate results for A0A174F2W5

A0A174F2W5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174F2W5
DOMAINtad15/146ADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAA
SSLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPE
TAFRVLRSVLKN
DOMAINcd273/467TSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIFELPQKAGKDFGQVAAGK
EPASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAA
ADAEELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGS
YGYGYGYGAYSRAER
SITEWalker A280/282GKS
SITEWalker A'300/307LLLDCDFR
SITEWalker B382/388IILDTPP
SITE-342/-348YKDTNVY
SITEY Cluster453/462YGYGYGYGAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAASSLSST
              ADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAASSLSST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYIIPNVVL
YEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKN              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETLQQPQVSGNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSSMLITN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIFELPQK
                                TSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIFELPQK
                                       GKS                 LLLDCDFR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGKDFGQVAAGKEPASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADAEELVE
AGKDFGQVAAGKEPASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADAEELVE
                                                             IILDTPP            
       410       420       430       440       450       460       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
LADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
LADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
                                                    YGYGYGYGAY     
© 1998-2019