BYKdb

Annotate results for A0A174F3S2

A0A174F3S2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174F3S2
DOMAINcd304/493TSAVPGEGKTTVAVNLAEAFAKKKYRVVLLDGDLRNPSVMKCMGLIGRKERGIAAVLKGQ
MDWEEALTDCRDLTLKILPGAGSTQNPAGLLRSVRMKTMIESLKEEADLLIIDTPPCGVL
SDAALFGGIADGAVLVVHQGTTKDREVRRALEFFEDSQVPVCGYVLNGVQEGTTGYGYSS
YGGYGYGKYG
SITEWalker A311/313GKT
SITEWalker A'331/338VLLDGDLR
SITEWalker B413/419LIIDTPP
SITEY Cluster479/501YGYSSYGGYGYGKYGYGYGKYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVTVTDTAPIAGQNDEREQKSMNRETYETYSAAEPEKIDLIAFLAEYFQAFQKFFFGVLALVILAGGGSFLTAKLRYQPV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YEAYTSFVVGSNRAVGYSYYDNVTAEQLGKTFPYLVTSGVLKDVVARDLGIGAVTSEIQASVMENTNLFTIRVRDASPET


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYRVMKSVITNYPEVAEYIIGATTLTVVDESGVPAVPVNSQDALRAGTYGAAAGLAAAFLLLFLYVRTRKTIHWADDIKK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTNAAFLGNLPQAKIKKRSSVKEQTITICNPKVPDAFKEAVQLIRTRMENRIIGKSDCPVLLVTSAVPGEGKTTVAVNLA
                                                               TSAVPGEGKTTVAVNLA
                                                                      GKT       
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAFAKKKYRVVLLDGDLRNPSVMKCMGLIGRKERGIAAVLKGQMDWEEALTDCRDLTLKILPGAGSTQNPAGLLRSVRMK
EAFAKKKYRVVLLDGDLRNPSVMKCMGLIGRKERGIAAVLKGQMDWEEALTDCRDLTLKILPGAGSTQNPAGLLRSVRMK
          VLLDGDLR                                                              
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMIESLKEEADLLIIDTPPCGVLSDAALFGGIADGAVLVVHQGTTKDREVRRALEFFEDSQVPVCGYVLNGVQEGTTGYG
TMIESLKEEADLLIIDTPPCGVLSDAALFGGIADGAVLVVHQGTTKDREVRRALEFFEDSQVPVCGYVLNGVQEGTTGYG
            LIIDTPP                                                           YG
       490       500       510       520 
....:....|....:....|....:....|....:....|.
YSSYGGYGYGKYGYGYGKYGYGKEKERRNSDRTAREQGGKA
YSSYGGYGYGKYG                            
YSSYGGYGYGKYGYGYGKYGY                    
© 1998-2019