BYKdb

Annotate results for A0A174F9H9

A0A174F9H9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174F9H9
DOMAINcd39/231TSCTPNEGKSTVSLSVSSSLAEAGKKVLFIDADLRKSVLAGRQKLTGAMKGLSHFLAGQA
EVGDIMYKTQKAGLVVMFAGVVPPNPAELLGHKRFENLISSARKVYDYIIIDAPPLGSVI
DSAIIAKQCDAAVMVIASQAISYKFAKNVKKQLEKSECPILGVVLNKVDMKLNQYYGRYY
GRYYGKYYGNYGN
SITEWalker A46/48GKS
SITEWalker A'66/73LFIDADLR
SITEWalker B147/153IIIDAPP
SITE-144/-146YDY
SITEY Cluster213/229YYGRYYGRYYGKYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQEIVLKGMDKDFRSNEAYKTLRTNIEFSGADNKVIVFTSCTPNEGKSTVSLSVSSSLAEAGKKVLFIDADLRKSVLAGR
                                      TSCTPNEGKSTVSLSVSSSLAEAGKKVLFIDADLRKSVLAGR
                                             GKS                 LFIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKLTGAMKGLSHFLAGQAEVGDIMYKTQKAGLVVMFAGVVPPNPAELLGHKRFENLISSARKVYDYIIIDAPPLGSVIDS
QKLTGAMKGLSHFLAGQAEVGDIMYKTQKAGLVVMFAGVVPPNPAELLGHKRFENLISSARKVYDYIIIDAPPLGSVIDS
                                                                  IIIDAPP       
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
AIIAKQCDAAVMVIASQAISYKFAKNVKKQLEKSECPILGVVLNKVDMKLNQYYGRYYGRYYGKYYGNYGNEE
AIIAKQCDAAVMVIASQAISYKFAKNVKKQLEKSECPILGVVLNKVDMKLNQYYGRYYGRYYGKYYGNYGN  
                                                    YYGRYYGRYYGKYYGNY    
© 1998-2019