BYKdb

Annotate results for A0A174FPA3

A0A174FPA3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174FPA3
DOMAINtad16/257GGINLRDVVELIIANWYWFVLSVLVCVGSAYFYVLTIQPVYQRQAVMLVKDKEKSASDMS
AMLEVSGGITGTSVDNEIYILRSHQLLREVVNRLHLDVGYAKDGILRDAPLYAESPVEVH
FIDPYNQPVSFNITPLNTTKFRISDWKVAGEKGRMQEQDLTYNDTIRTEAGRIVVQLRPE
NLSAYLSQPISVSRISPEIATNIYQSKIATSLAGERTTLVQITCSDTNISRADAILAALV
KV
DOMAINcd589/780TSTLSGEGKSFVSRNLAVALAISGKKVILLDTDLRKHTQSKLAGVNRKEGLSTYLSGLNS
NPDTLITVGAFHPQVDTIFAGIIPPNPAELLMNERFDQLIDELKKRYDYIILDNVPALVV
ADAAIVSRVTDLTIYVIRDGVLDRRYLPELERLHQDGKFKNMCIVLNDSQVEKKKYGYGY
GQGYGYGYGYGY
SITEWalker A596/598GKS
SITEWalker A'616/623ILLDTDLR
SITEWalker B698/704IILDNVP
SITE-695/-697YDY
SITEY Cluster764/789YGYGYGQGYGYGYGYGYGYGHISGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEYIQENERTPKKDEGGINLRDVVELIIANWYWFVLSVLVCVGSAYFYVLTIQPVYQRQAVMLVKDKEKSASDMSAMLEV
               GGINLRDVVELIIANWYWFVLSVLVCVGSAYFYVLTIQPVYQRQAVMLVKDKEKSASDMSAMLEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGGITGTSVDNEIYILRSHQLLREVVNRLHLDVGYAKDGILRDAPLYAESPVEVHFIDPYNQPVSFNITPLNTTKFRISD
SGGITGTSVDNEIYILRSHQLLREVVNRLHLDVGYAKDGILRDAPLYAESPVEVHFIDPYNQPVSFNITPLNTTKFRISD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WKVAGEKGRMQEQDLTYNDTIRTEAGRIVVQLRPENLSAYLSQPISVSRISPEIATNIYQSKIATSLAGERTTLVQITCS
WKVAGEKGRMQEQDLTYNDTIRTEAGRIVVQLRPENLSAYLSQPISVSRISPEIATNIYQSKIATSLAGERTTLVQITCS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQRNQIVDMSANATQYLAESSK
DTNISRADAILAALVKV                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKEESAQLETELSIARSIKTYLADVTRKDQLIPNVTGVGDVSMQSQITAYNELMLQRNRLKESSGEKNPVVQAADKNLEG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRATISGSMDNYMKTLRLRLDKAKAVENRLASSIQAVPKQEKMALSIMRQQSIKETLYTFLLNKREENALQLAITEANIR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVEEPFGSYSPVSPARSSILAAAFIVGLLIPLGVQVIILLLNTSVRGRKDIEEYTTIPIVGEIPARKDSEGDDAIVVSDS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNDRISEAFRMLRVDLNFIAKEARVLMFTSTLSGEGKSFVSRNLAVALAISGKKVILLDTDLRKHTQSKLAGVNRKEGLS
                            TSTLSGEGKSFVSRNLAVALAISGKKVILLDTDLRKHTQSKLAGVNRKEGLS
                                   GKS                 ILLDTDLR                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYLSGLNSNPDTLITVGAFHPQVDTIFAGIIPPNPAELLMNERFDQLIDELKKRYDYIILDNVPALVVADAAIVSRVTDL
TYLSGLNSNPDTLITVGAFHPQVDTIFAGIIPPNPAELLMNERFDQLIDELKKRYDYIILDNVPALVVADAAIVSRVTDL
                                                         IILDNVP                
       730       740       750       760       770       780       790       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
TIYVIRDGVLDRRYLPELERLHQDGKFKNMCIVLNDSQVEKKKYGYGYGQGYGYGYGYGYGYGHISGYYSEENKDKK
TIYVIRDGVLDRRYLPELERLHQDGKFKNMCIVLNDSQVEKKKYGYGYGQGYGYGYGYGY                 
                                           YGYGYGQGYGYGYGYGYGYGHISGYY        

© 1998-2019