BYKdb

Annotate results for A0A174GB62

A0A174GB62 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174GB62
DOMAINcd40/232TSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVGRYRVKKGVKGLTHFLSGQN
TLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVI
DAAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKIKIIGSVLNKVDLSENGYYGRYY
GKYYGKYYGSYYG
SITEWalker A47/49GKS
SITEWalker A'67/74LFIDCDLR
SITEWalker B148/154VIIDTPP
SITE-145/-147YDY
SITEY Cluster214/234YYGRYYGKYYGKYYGSYYGHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQTINIETNQQDDYQVRESYRNLRTNIFLSGKDTKVVMFTSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
                                       TSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
                                              GKS                 LFIDCDLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
                                                                   VIIDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKIKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYGHYNSEESP
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKIKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYG        
                                                     YYGRYYGKYYGKYYGSYYGHY      
       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
DKSFEKARKASSARKNTNNASKPVKRQAGSVGEVAARKKANAAGNNTGVRKKPSADEFDGDFLMDYDEK


© 1998-2019