BYKdb

Annotate results for A0A174H2B5

A0A174H2B5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174H2B5
DOMAINcd40/232TSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVGRYKINTSVKGLTHFLSGIN
KFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVI
DSAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYY
GKYYGKYGEHANK
SITEWalker A47/49GKS
SITEWalker A'67/74IFIDADLR
SITEWalker B148/154IIIDTPP
SITE-145/-184YDYIIIDTPPIGSVIDSAIVAQECDGVAYVMAANDVSYKY
SITEY Cluster214/226YYGKYYGKYYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQTINIERLRKLDYRANEAYKNLRTNIQLCGSDIKVIMLTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
                                       TSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
                                              GKS                 IFIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKINTSVKGLTHFLSGINKFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVID
RYKINTSVKGLTHFLSGINKFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVID
                                                                   IIIDTPP      
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
SAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYYGKYYGKYGEHANK
SAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYYGKYYGKYGEHANK
                                                     YYGKYYGKYYGKY      
© 1998-2019