BYKdb

Annotate results for A0A174HZ21

A0A174HZ21 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174HZ21
DOMAINcd57/249TSSAPNEGKSETTFQLAASMAQLGKKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQC
KKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARECYDYILIDSPPMGSVI
DGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGK
YGKYYGYGHENAK
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDADIR
SITEWalker B165/171ILIDSPP
SITE-162/-164YDY
SITEY Cluster231/243YYYYGKYGKYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHDEIVIEDLISPDERGMGELVLKGFEVNDYQYEEAMKTLRTNIQFSGSNIHAVMFTSSAPNEGKSETTFQLAASMAQLG
                                                        TSSAPNEGKSETTFQLAASMAQLG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQCKKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARE
KKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQCKKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARE
   LLIDADIR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CYDYILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGKYGKY
CYDYILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGKYGKY
    ILIDSPP                                                           YYYYGKYGKY
       250       
....:....|....:..
YGYGHENAKQGKEAKVL
YGYGHENAK        
YGY              
© 1998-2019