BYKdb

Annotate results for A0A174KXI0

A0A174KXI0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174KXI0
DOMAINcd38/225TSSEPGEGKTVTSGNLSLALAQGESKVLLVDCDMRKPTIHKNFKISNQDGLTDLLLHKKT
MEQVMVKYNENLTIIPAGRVSPNPSEMLGSRAMSAFLEEMKNHFDYIVMDTPPLGAVTDA
QVLSTKVDATILVVKAGDTKRDVVMNSVNLIKKVNGNLIGTVLNGVEKSNNKYYYYYGSE
EVAATAEK
SITEWalker A45/47GKT
SITEWalker A'65/72LLVDCDMR
SITEWalker B144/150IVMDTPP
SITEY Cluster210/214YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFVVEKKPKSVAAESYRTLRTNIQYSSFDKEYRTIVITSSEPGEGKTVTSGNLSLALAQGESKVLLVDCDMRKPTIHKNF
                                     TSSEPGEGKTVTSGNLSLALAQGESKVLLVDCDMRKPTIHKNF
                                            GKT                 LLVDCDMR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KISNQDGLTDLLLHKKTMEQVMVKYNENLTIIPAGRVSPNPSEMLGSRAMSAFLEEMKNHFDYIVMDTPPLGAVTDAQVL
KISNQDGLTDLLLHKKTMEQVMVKYNENLTIIPAGRVSPNPSEMLGSRAMSAFLEEMKNHFDYIVMDTPPLGAVTDAQVL
                                                               IVMDTPP          
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
STKVDATILVVKAGDTKRDVVMNSVNLIKKVNGNLIGTVLNGVEKSNNKYYYYYGSEEVAATAEKKKRK
STKVDATILVVKAGDTKRDVVMNSVNLIKKVNGNLIGTVLNGVEKSNNKYYYYYGSEEVAATAEK    
                                                 YYYYY               
© 1998-2019