BYKdb

Annotate results for A0A174LG87

A0A174LG87 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174LG87
DOMAINcd98/287TSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLNNAIEGKAH
WKSQVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNE
PMTINEMMDATLFIVRQDYAEKDMINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGY
RYGYNRYRTK
SITEWalker A105/107GKS
SITEWalker A'125/132ILVDMDFR
SITEWalker B205/211VIVDVSP
SITE-202/-204YDY
SITEY Cluster275/284YGYRYGYNRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKGALASGAVLVFILALYYFFRDTVKSDKEAKQKLNARLYARIPFEKKKKRNPFKKNRKAILITSLKTSFFYRESINKLR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKVEASSQKHGYTSFMITSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLNNAIEGKAHWKS
                 TSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLNNAIEGKAHWKS
                        GKS                 ILVDMDFR                            
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATLFIVRQDYAEKD
QVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATLFIVRQDYAEKD
                                            VIVDVSP                             
       250       260       270       280       290
....:....|....:....|....:....|....:....|....:....|
MINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTKGGE
MINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTK   
                                  YGYRYGYNRY      
© 1998-2019