BYKdb

Annotate results for A0A174LKL4

A0A174LKL4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174LKL4
DOMAINcd281/470TSSVPGEGKTTVAVNLAEAFAKKKYRVVLLDGDLRNPSVLKCIGLSERKGRGIIGVLKGQ
ISLDEALTDYRDLSLKILPGVGSTQNPAGLLRSARMKTLIEELKEDADLLIIDTPPCGVL
SDASLLGGIADSAVLVVHQGTTKDREVQRALEFFEDSQIPVCGYVLNGVPEGATGYGYST
YGGYGYGKYG
SITEWalker A288/290GKT
SITEWalker A'308/315VLLDGDLR
SITEWalker B390/396LIIDTPP
SITEY Cluster456/478YGYSTYGGYGYGKYGYGYGKYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRETYETYSAEPEKIDLIAFLAEYFQAFRKFFLGVLILVILMGGGSFLTAKLRYQPMYEAYTSFVVGSNRAVGYSYYDN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTAQQLGKTFPYIVTSGVLKDVVARDLQVGAVTSQIEASVMENTNLFTIRVKDSSPDTAYRVLQSVITNYPEVAEYIIGA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTLTVVDDSGVPVSPINSQDAVHAGMIGAAAGLAVALLLVFIYVRTRKTIRQADDVKKLTNAAFLGNLPEAKIKKRSNVK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQTITICNPKVPDSFKEAMQLIRTRTEDGIGKADCPVLLVTSSVPGEGKTTVAVNLAEAFAKKKYRVVLLDGDLRNPSVL
                                        TSSVPGEGKTTVAVNLAEAFAKKKYRVVLLDGDLRNPSVL
                                               GKT                 VLLDGDLR     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KCIGLSERKGRGIIGVLKGQISLDEALTDYRDLSLKILPGVGSTQNPAGLLRSARMKTLIEELKEDADLLIIDTPPCGVL
KCIGLSERKGRGIIGVLKGQISLDEALTDYRDLSLKILPGVGSTQNPAGLLRSARMKTLIEELKEDADLLIIDTPPCGVL
                                                                     LIIDTPP    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDASLLGGIADSAVLVVHQGTTKDREVQRALEFFEDSQIPVCGYVLNGVPEGATGYGYSTYGGYGYGKYGYGYGKYGYGK
SDASLLGGIADSAVLVVHQGTTKDREVQRALEFFEDSQIPVCGYVLNGVPEGATGYGYSTYGGYGYGKYG          
                                                       YGYSTYGGYGYGKYGYGYGKYGY  
       490   
....:....|...
EKEGRKSNQSVKE


© 1998-2019