BYKdb

Annotate results for A0A174LN64

A0A174LN64 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174LN64
DOMAINcd39/228TSCTPNEGKSSVSMQLGISLAESGKRVILIDADLRKSVLLGRTKTQKSVRGLAHFLSGQA
TLEDVICSTNVKNFYMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDYVIVDTPPLGSVI
DSAIVAEICDGSIMVIESGVISYRFAQEVKSQLERSNCPLLGVVLNKVDMQKQAYGKYGK
YGQYKYGDYG
SITEWalker A46/48GKS
SITEWalker A'66/73ILIDADLR
SITEWalker B147/153VIVDTPP
SITE-113/-146YMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDY
SITEY Cluster213/227YGKYGKYGQYKYGDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQVVVKQEKSGYQIVEAYKSLRTNLQFCGEDKKVIAVTSCTPNEGKSSVSMQLGISLAESGKRVILIDADLRKSVLLGR
                                      TSCTPNEGKSSVSMQLGISLAESGKRVILIDADLRKSVLLGR
                                             GKS                 ILIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKTQKSVRGLAHFLSGQATLEDVICSTNVKNFYMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDYVIVDTPPLGSVIDS
TKTQKSVRGLAHFLSGQATLEDVICSTNVKNFYMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDYVIVDTPPLGSVIDS
                                                                  VIVDTPP       
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
AIVAEICDGSIMVIESGVISYRFAQEVKSQLERSNCPLLGVVLNKVDMQKQAYGKYGKYGQYKYGDYGQEEDD
AIVAEICDGSIMVIESGVISYRFAQEVKSQLERSNCPLLGVVLNKVDMQKQAYGKYGKYGQYKYGDYG     
                                                    YGKYGKYGQYKYGDY      
© 1998-2019