BYKdb

Annotate results for A0A174M0R1

A0A174M0R1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174M0R1
DOMAINcd38/216TSSELGEGKTVTSGNLALALAQGENKVLLIDCDMRKPSIHKNFRISNESGLSELLLHKKT
MENISWKYNDNLTLIPAGKVPPNPSEMLGSRVMGTFLDEMKKHFDYIVIDTPPLGAVTDA
QVLSTKVDGTILVVKAGSTKKDVVMNSVNLIKKVNGNLIGTVLNGVEKSKNKYYYYYGN
SITEWalker A45/47GKT
SITEWalker A'65/72LLIDCDMR
SITEWalker B144/150IVIDTPP
SITEY Cluster210/214YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFVVEKQPKSIAAESYRTLRTNIQYSSFDKEYRTIVVTSSELGEGKTVTSGNLALALAQGENKVLLIDCDMRKPSIHKNF
                                     TSSELGEGKTVTSGNLALALAQGENKVLLIDCDMRKPSIHKNF
                                            GKT                 LLIDCDMR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RISNESGLSELLLHKKTMENISWKYNDNLTLIPAGKVPPNPSEMLGSRVMGTFLDEMKKHFDYIVIDTPPLGAVTDAQVL
RISNESGLSELLLHKKTMENISWKYNDNLTLIPAGKVPPNPSEMLGSRVMGTFLDEMKKHFDYIVIDTPPLGAVTDAQVL
                                                               IVIDTPP          
       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
STKVDGTILVVKAGSTKKDVVMNSVNLIKKVNGNLIGTVLNGVEKSKNKYYYYYGN
STKVDGTILVVKAGSTKKDVVMNSVNLIKKVNGNLIGTVLNGVEKSKNKYYYYYGN
                                                 YYYYY  
© 1998-2019