BYKdb

Annotate results for A0A174NEJ4

A0A174NEJ4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174NEJ4
DOMAINcd40/236TSSTPNEGKSSLSFQLAVSFAEADNRVLFIDADIRKSVLVGRYKAEGNKFGLTHYLSGQK
TIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFADLIGMAREEYDYVIIDAPPLGSVI
DAALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYY
GKYYGKYYGNYGEETKK
SITEWalker A47/49GKS
SITEWalker A'67/74LFIDADIR
SITEWalker B148/154VIIDAPP
SITE-145/-147YDY
SITEY Cluster214/230YYGNYYGKYYGKYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKVLLRKHDKLDFRANEAFKTLRTNILFSGHDTRVITLTSSTPNEGKSSLSFQLAVSFAEADNRVLFIDADIRKSVLVG
                                       TSSTPNEGKSSLSFQLAVSFAEADNRVLFIDADIRKSVLVG
                                              GKS                 LFIDADIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFADLIGMAREEYDYVIIDAPPLGSVID
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFADLIGMAREEYDYVIIDAPPLGSVID
                                                                   VIIDAPP      
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGNYGEETKK
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGNYGEETKK
                                                     YYGNYYGKYYGKYYGNY      
© 1998-2019