BYKdb

Annotate results for A0A174NGP8

A0A174NGP8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174NGP8
DOMAINcd41/230TSCTPNEGKSTVTLQLAASLAEAGKKVLFLDADLRKSVLMGRHRVAGEVKGLSHFLSGQV
EIKDIILKTQEPNLYVAFAGVVPPNPSELLGNRRFEALLNGARQAYDYVIIDAPPLGNVI
DAAVIAKNCDASVLVVASREISYKYARVVKEQLELAGCPILGVVLNKVDLKQNKYYGNKY
YSKYYGKYYG
SITEWalker A48/50GKS
SITEWalker A'68/75LFLDADLR
SITEWalker B149/155VIIDAPP
SITE-146/-185YDYVIIDAPPLGNVIDAAVIAKNCDASVLVVASREISYKY
SITEY Cluster215/232YYGNKYYSKYYGKYYGEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MADVILKNLKEINDYRSNESYKTLRTNIEFSGSDKKVIVFTSCTPNEGKSTVTLQLAASLAEAGKKVLFLDADLRKSVLM
                                        TSCTPNEGKSTVTLQLAASLAEAGKKVLFLDADLRKSVLM
                                               GKS                 LFLDADLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRHRVAGEVKGLSHFLSGQVEIKDIILKTQEPNLYVAFAGVVPPNPSELLGNRRFEALLNGARQAYDYVIIDAPPLGNVI
GRHRVAGEVKGLSHFLSGQVEIKDIILKTQEPNLYVAFAGVVPPNPSELLGNRRFEALLNGARQAYDYVIIDAPPLGNVI
                                                                    VIIDAPP     
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
DAAVIAKNCDASVLVVASREISYKYARVVKEQLELAGCPILGVVLNKVDLKQNKYYGNKYYSKYYGKYYGEYKKED
DAAVIAKNCDASVLVVASREISYKYARVVKEQLELAGCPILGVVLNKVDLKQNKYYGNKYYSKYYGKYYG      
                                                      YYGNKYYSKYYGKYYGEY    
© 1998-2019