BYKdb

Annotate results for A0A174R7V0

A0A174R7V0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174R7V0
DOMAINtad11/142QQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIY
QNLNSTKELASQFTEILGSNVLKKKVAQDLGMNNLNVKTSVDLVPETNLITFSVKAETAA
ESYRVLQSVMEN
DOMAINcd278/467TSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIFNVRDNEEKDLGDVLINH
ASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALV
ADTEELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHY
GYGGHYGKRA
SITEWalker A285/287GKS
SITEWalker A'305/312MLIDCDFR
SITEWalker B387/393VVIDTSP
SITEY Cluster457/463YGYGGHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
          QQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQFTEILGSNVLKKKVAQDLGMNNLNVKTSVDLVPETNLITFSVKAETAAESYRVLQSVMENYNTVSDYAIKNVIIETIQ
SQFTEILGSNVLKKKVAQDLGMNNLNVKTSVDLVPETNLITFSVKAETAAESYRVLQSVMEN                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPSVAMAPINPLDEKRTVMKVFVVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
                                     TSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
                                            GKS                 MLIDCDFR        
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVRDNEEKDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
NVRDNEEKDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
                                                                  VVIDTSP       
       410       420       430       440       450       460       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
                                                        YGYGGHY    
© 1998-2019