BYKdb

Annotate results for A0A174RPZ9

A0A174RPZ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174RPZ9
DOMAINcd189/378TSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLNNAIEGKAH
WKSQVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNE
PMTINEMMDATLFIVRQDYAEKDMINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGY
RYGYNRYRTK
SITEWalker A196/198GKS
SITEWalker A'216/223ILVDMDFR
SITEWalker B296/302VIVDVSP
SITE-293/-295YDY
SITEY Cluster366/375YGYRYGYNRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSKNARAYVKKKMDISSTTYTATISTQQANIINFNVTADTKKEAYYAIGYLTEWYAGSTERYNFPYAINILDESSFSTA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVNYNSHKGNFMKGALASGAVLVFILALYYFFRDTVKSDKEAKQKLNARLYARIPFEKKKKRNPFKKNRKAILITSLKTS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FFYRESINKLRSKVEASSQKHGYTSFMITSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLN
                            TSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLN
                                   GKS                 ILVDMDFR                 
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAIEGKAHWKSQVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATL
NAIEGKAHWKSQVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATL
                                                       VIVDVSP                  
       330       340       350       360       370       380 
....:....|....:....|....:....|....:....|....:....|....:....|.
FIVRQDYAEKDMINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTKGGE
FIVRQDYAEKDMINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTK   
                                             YGYRYGYNRY      
© 1998-2019