BYKdb

Annotate results for A0A174SRI6

A0A174SRI6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174SRI6
DOMAINcd38/215TSAEPGEGKSITSGNLALAFAHDEKKVILIDCDLRRPSLHKKFRISNNKGLSDAIINKDK
LSDFIQKRTEYLDILTAGKIPPNPSEMLGSQAMSSLLDELSNIYDVIVLDSPPVLAVTDA
QILSTKTDGTILVVRGEKTKKDTVLAAKEVLTKVNANILGTVLNGGNKNKDNYYYHYE
SITEWalker A45/47GKS
SITEWalker A'65/72ILIDCDLR
SITEWalker B144/150IVLDSPP
SITEY Cluster210/214YYYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLILEKQPKSIEAESYRILRTNIMYSSFDKEIKRILVTSAEPGEGKSITSGNLALAFAHDEKKVILIDCDLRRPSLHKKF
                                     TSAEPGEGKSITSGNLALAFAHDEKKVILIDCDLRRPSLHKKF
                                            GKS                 ILIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RISNNKGLSDAIINKDKLSDFIQKRTEYLDILTAGKIPPNPSEMLGSQAMSSLLDELSNIYDVIVLDSPPVLAVTDAQIL
RISNNKGLSDAIINKDKLSDFIQKRTEYLDILTAGKIPPNPSEMLGSQAMSSLLDELSNIYDVIVLDSPPVLAVTDAQIL
                                                               IVLDSPP          
       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
STKTDGTILVVRGEKTKKDTVLAAKEVLTKVNANILGTVLNGGNKNKDNYYYHYE
STKTDGTILVVRGEKTKKDTVLAAKEVLTKVNANILGTVLNGGNKNKDNYYYHYE
                                                 YYYHY 
© 1998-2019