BYKdb

Annotate results for A0A174TU68

A0A174TU68 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174TU68
DOMAINcd43/229TSSNASEGKTTTICNLAVSFAQIGKKVLIIDGDLRRPRLHTYLNVSNVKGLSNVLTHQAT
LEEAMKETVLDIQVLTCGPIPPNPSELLNSNRLKQLLVELKSQFDIILIDTPPVGVVTDA
AILSTLVDGTLIVVASHQTESDQAVRAMKLLNNVGARILGSVLTKVPADRKGYYGYQYYE
YTQEHES
SITEWalker A50/52GKT
SITEWalker A'70/77LIIDGDLR
SITEWalker B149/155ILIDTPP
SITEY Cluster215/223YYGYQYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSMPTIISLSNPKSPEAEAYRTLRTNLQFSTVDHELQTLLVTSSNASEGKTTTICNLAVSFAQIGKKVLIIDGDLRRPR
                                          TSSNASEGKTTTICNLAVSFAQIGKKVLIIDGDLRRPR
                                                 GKT                 LIIDGDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHTYLNVSNVKGLSNVLTHQATLEEAMKETVLDIQVLTCGPIPPNPSELLNSNRLKQLLVELKSQFDIILIDTPPVGVVT
LHTYLNVSNVKGLSNVLTHQATLEEAMKETVLDIQVLTCGPIPPNPSELLNSNRLKQLLVELKSQFDIILIDTPPVGVVT
                                                                    ILIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAILSTLVDGTLIVVASHQTESDQAVRAMKLLNNVGARILGSVLTKVPADRKGYYGYQYYEYTQEHESKKRTRRLKKAK
DAAILSTLVDGTLIVVASHQTESDQAVRAMKLLNNVGARILGSVLTKVPADRKGYYGYQYYEYTQEHES           
                                                      YYGYQYYEY                 
  
..
AR


© 1998-2019