BYKdb

Annotate results for A0A174TVL8

A0A174TVL8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174TVL8
DOMAINtad14/250KSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQ
LNNSDFTGLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFL
DAGMDEAHSLSVTPKSRQQVELADFSRGMEQRKVVNLNDTIHTALGRLIVFAAENYGESS
FGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRAADILDMLITI
DOMAINcd586/777TSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYLSDSSV
EVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLV
ADATVVNRITDLTLFIVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGY
GYNYGYGYAATQ
SITEWalker A593/595GKT
SITEWalker A'613/620VLLDLDLR
SITEWalker B695/701IIVDNVP
SITE-692/-694YDY
SITEY Cluster761/773YGYGYGYNYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
             KSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
ADILDMLITI                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
                         TSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
                                GKT                 VLLDLDLR                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
                                                      IIVDNVP                   
       730       740       750       760       770       780       790
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQ             
                                        YGYGYGYNYGYGY                 

© 1998-2019