BYKdb

Annotate results for A0A174TYU6

A0A174TYU6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174TYU6
DOMAINtad14/255DFIRIQDLWGMFVPRWHWFALSLFAALAVAAFYLLSTPNIYTRTAAILVKDDTKSGSSTT
MSEFSDLGIFKSNTNINNELLTLKSPTLMTEVVRRLGLNETYTVRKGLKDVGLYKSNPVA
VSYRHQDETPVSFKIDFSSKEEFTISDVMINGEELETEFSGKMGDSIRMEVGTFVINPTK
YWNDSFVGTSIRYNKGSVRAVTDYYATALRADLGNEDATIINLSIDDVSIPKAEDILNTL
IE
DOMAINcd600/790TSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGSVSSYVDSPRIGLSDYLGNRVEN
WKEIIVADKKYDNLHILPIGTVPPNPTELLEDGKLATLIGALRGEYDYIFIDCPPIDIVA
DAQIIEKLADRTIFVVRSGLLDRGMLPELENIYQEKRFRNLSVILNGTESAGGRYSYRYG
YRYGYRYGYHN
SITEWalker A607/609GKS
SITEWalker A'627/634LVIDGDLR
SITEWalker B708/714IFIDCPP
SITE-705/-707YDY
SITEY Cluster774/796YSYRYGYRYGYRYGYHNGYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIEKKTAVGKPADDFIRIQDLWGMFVPRWHWFALSLFAALAVAAFYLLSTPNIYTRTAAILVKDDTKSGSSTTMSEFSDL
             DFIRIQDLWGMFVPRWHWFALSLFAALAVAAFYLLSTPNIYTRTAAILVKDDTKSGSSTTMSEFSDL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIFKSNTNINNELLTLKSPTLMTEVVRRLGLNETYTVRKGLKDVGLYKSNPVAVSYRHQDETPVSFKIDFSSKEEFTISD
GIFKSNTNINNELLTLKSPTLMTEVVRRLGLNETYTVRKGLKDVGLYKSNPVAVSYRHQDETPVSFKIDFSSKEEFTISD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VMINGEELETEFSGKMGDSIRMEVGTFVINPTKYWNDSFVGTSIRYNKGSVRAVTDYYATALRADLGNEDATIINLSIDD
VMINGEELETEFSGKMGDSIRMEVGTFVINPTKYWNDSFVGTSIRYNKGSVRAVTDYYATALRADLGNEDATIINLSIDD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAEN
VSIPKAEDILNTLIE                                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKELLALNSQLSTAQYIRRELNNKELSQLLPTNSGIANVNIESQIGEYNTMVLDRNRLIANSSEKNPLAKDMANSLQSMQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTIIQSVDNLIVSLNTQIRSIRQQEAATTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRVI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAPRGSMFPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLEDLSIPFIGEIPQYFSKERKLGFKRKKQSYM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTIVVKEGSRDIINEAFRVLRSNMDFMAGKDKGQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGSVSS
                                       TSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGSVSS
                                              GKS                 LVIDGDLR      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVDSPRIGLSDYLGNRVENWKEIIVADKKYDNLHILPIGTVPPNPTELLEDGKLATLIGALRGEYDYIFIDCPPIDIVAD
YVDSPRIGLSDYLGNRVENWKEIIVADKKYDNLHILPIGTVPPNPTELLEDGKLATLIGALRGEYDYIFIDCPPIDIVAD
                                                                   IFIDCPP      
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQIIEKLADRTIFVVRSGLLDRGMLPELENIYQEKRFRNLSVILNGTESAGGRYSYRYGYRYGYRYGYHNGYSSYYGSKG
AQIIEKLADRTIFVVRSGLLDRGMLPELENIYQEKRFRNLSVILNGTESAGGRYSYRYGYRYGYRYGYHN          
                                                     YSYRYGYRYGYRYGYHNGYSSYY    
       810   
....:....|...
EMGGVNGWLSNNR


© 1998-2019