BYKdb

Annotate results for A0A174UFK0

A0A174UFK0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174UFK0
DOMAINcd40/232TSSTPNEGKSSLSFQLAISFAEADNRVLFIDADIRKSVLVGRYKAEGNKFGLTHYLSGQK
TIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFAELIQKAREEYDYVIIDAPPLGSVI
DAALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYY
GKYYGKYYGKYYG
SITEWalker A47/49GKS
SITEWalker A'67/74LFIDADIR
SITEWalker B148/154VIIDAPP
SITE-145/-147YDY
SITEY Cluster214/234YYGNYYGKYYGKYYGKYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKVLLRKHEKLDFRANEAFKTLRTNILFSGHDTRVITLTSSTPNEGKSSLSFQLAISFAEADNRVLFIDADIRKSVLVG
                                       TSSTPNEGKSSLSFQLAISFAEADNRVLFIDADIRKSVLVG
                                              GKS                 LFIDADIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFAELIQKAREEYDYVIIDAPPLGSVID
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFAELIQKAREEYDYVIIDAPPLGSVID
                                                                   VIIDAPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGKYYGNYGEETKK
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGKYYG        
                                                     YYGNYYGKYYGKYYGKYYGNY      
    
....
QDKK


© 1998-2019