BYKdb

Annotate results for A0A174UR09

A0A174UR09 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A174UR09
DOMAINtad16/261DFLRIQDLLFLCLAKWQWFVLSLVVTVGAATVYLLRTPAVYTCTASVLIKEDSKGKSVSS
DLESFSEFGLFQSSTNVNNELIAFRSPALMTEMVKRLRLDMNYFVPGKFHRQVAYGLTLP
VDVTINDVPENESAGFTLEVQPDGTLFLSDFIRNGTELDEKDIKGNLLDSIPTPLGKIII
HTTPNYVKGEAYILYISKSSLYNAVNSYSSNLSVSLNNEKASVIDLSLKDNSTQRAEDVL
SMLISV
DOMAINcd604/794TSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGSASSYIDSPAKGLSDYLGGRIDN
LDEIIVPDPRHKSMDILPVGTIPPNPTELLFDERLKQAIDTIREQYDYVLIDCPPIELVA
DTQIIEKQADRTIFVVRTGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYG
YRYGYHYGYGS
SITEWalker A611/613GKS
SITEWalker A'631/638LVIDGDLR
SITEWalker B712/718VLIDCPP
SITE-709/-711YDY
SITEY Cluster756/798YEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMTINQKNTKPGQQDDFLRIQDLLFLCLAKWQWFVLSLVVTVGAATVYLLRTPAVYTCTASVLIKEDSKGKSVSSDLESF
               DFLRIQDLLFLCLAKWQWFVLSLVVTVGAATVYLLRTPAVYTCTASVLIKEDSKGKSVSSDLESF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEFGLFQSSTNVNNELIAFRSPALMTEMVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDVPENESAGFTLEVQPDGT
SEFGLFQSSTNVNNELIAFRSPALMTEMVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDVPENESAGFTLEVQPDGT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFLSDFIRNGTELDEKDIKGNLLDSIPTPLGKIIIHTTPNYVKGEAYILYISKSSLYNAVNSYSSNLSVSLNNEKASVID
LFLSDFIRNGTELDEKDIKGNLLDSIPTPLGKIIIHTTPNYVKGEAYILYISKSSLYNAVNSYSSNLSVSLNNEKASVID

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSLKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMA
LSLKDNSTQRAEDVLSMLISV                                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSSQTNAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESTNIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALASMRGAIIRSIDNRIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPVVIIFTRENMNTRVRGRKDLENVTVPFIGEIPLFTRKKKGIFGKK


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQEVKAVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHG
                                           TSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHG
                                                  GKS                 LVIDGDLR  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SASSYIDSPAKGLSDYLGGRIDNLDEIIVPDPRHKSMDILPVGTIPPNPTELLFDERLKQAIDTIREQYDYVLIDCPPIE
SASSYIDSPAKGLSDYLGGRIDNLDEIIVPDPRHKSMDILPVGTIPPNPTELLFDERLKQAIDTIREQYDYVLIDCPPIE
                                                                       VLIDCPP  
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVADTQIIEKQADRTIFVVRTGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGS
LVADTQIIEKQADRTIFVVRTGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGS      
                                   YEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHY  
         
....:....
DKTRGVGGG


© 1998-2019