BYKdb

Annotate results for A0A174UYE6

A0A174UYE6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174UYE6
DOMAINcd40/229TSTIPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMGHYRVDQETRGLSHYLVGQE
SAENVAYRTNIENMDIIFAGPSTPNPAELLGNAKFEEMLCGAREHYDYVLIDSPPLGSVI
DAAIIAKNVDGSVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVNQESKGYYGGYY
NKYYGKNYGK
SITEWalker A47/49GKT
SITEWalker A'67/74LLLDADMR
SITEWalker B148/154VLIDSPP
SITE-145/-147YDY
SITEY Cluster214/233YYGGYYNKYYGKNYGKYSGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKVEFKKLPRLDFRANEAFKTLRTNITFCGDAQRVILFTSTIPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
                                       TSTIPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
                                              GKT                 LLLDADMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HYRVDQETRGLSHYLVGQESAENVAYRTNIENMDIIFAGPSTPNPAELLGNAKFEEMLCGAREHYDYVLIDSPPLGSVID
HYRVDQETRGLSHYLVGQESAENVAYRTNIENMDIIFAGPSTPNPAELLGNAKFEEMLCGAREHYDYVLIDSPPLGSVID
                                                                   VLIDSPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIIAKNVDGSVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVNQESKGYYGGYYNKYYGKNYGKYSGYGDGGSRG
AAIIAKNVDGSVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVNQESKGYYGGYYNKYYGKNYGK           
                                                     YYGGYYNKYYGKNYGKYSGY       
       250       260       270
....:....|....:....|....:....|
RAEKSEEKTEMKTAAAGGEENQVKRSRRRK


© 1998-2019