BYKdb

Annotate results for A0A174XJN9

A0A174XJN9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174XJN9
DOMAINcd40/232TSTAPNEGKTSTAFQLAVSLAEAGKKILFIDTDIRKSVLVHKLNLSKKINGLSQALSGQI
EPNEIIYKTSKENLSIIFSGPYAPNASELLDNDVCRQLMADLKDKSKYSFDYIIVDTPPL
GNVIDAAIVSKYCDGAVLVVEADRISSRWVRRARQQLEKTGIRILGVVLNKVNPEKGSYY
YEKYGNYYNKYAG
SITEWalker A47/49GKT
SITEWalker A'67/74LFIDTDIR
SITEWalker B152/158IIVDTPP
SITE-147/-151YSFDY
SITEY Cluster218/234YYYEKYGNYYNKYAGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MECIELDHIGQFNRQYREEIKTLRTNIGFLSAAFTMIMFTSTAPNEGKTSTAFQLAVSLAEAGKKILFIDTDIRKSVLVH
                                       TSTAPNEGKTSTAFQLAVSLAEAGKKILFIDTDIRKSVLVH
                                              GKT                 LFIDTDIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLNLSKKINGLSQALSGQIEPNEIIYKTSKENLSIIFSGPYAPNASELLDNDVCRQLMADLKDKSKYSFDYIIVDTPPLG
KLNLSKKINGLSQALSGQIEPNEIIYKTSKENLSIIFSGPYAPNASELLDNDVCRQLMADLKDKSKYSFDYIIVDTPPLG
                                                                       IIVDTPP  
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
NVIDAAIVSKYCDGAVLVVEADRISSRWVRRARQQLEKTGIRILGVVLNKVNPEKGSYYYEKYGNYYNKYAGYY
NVIDAAIVSKYCDGAVLVVEADRISSRWVRRARQQLEKTGIRILGVVLNKVNPEKGSYYYEKYGNYYNKYAG  
                                                         YYYEKYGNYYNKYAGYY
© 1998-2019