BYKdb

Annotate results for A0A174Y0Y6

A0A174Y0Y6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174Y0Y6
DOMAINcd42/231TSCYPNEGKSDVAFQLAVEIGKMGKRVLIIDADIRKSSYIKRYQIKQKTNGLSQYLSGQV
ALEEVIYSTNYRNLEIIFSGPYAPNPSELLEQGRFSRLIEETRKAYDYVLIDTPPIINMS
DAAIVAKQCDGAILVIESEAVSRRDAMKAKDQLTKSGCKLLGAVLNKVDMKKEKYYSKYN
SYYYGKSKQE
SITE-226/-228GKS
SITEWalker A'69/76LIIDADIR
SITEWalker B150/156VLIDTPP
SITE-80/-112YIKRYQIKQKTNGLSQYLSGQVALEEVIYSTNY
SITE-147/-149YDY
SITEY Cluster216/225YYSKYNSYYY
SITEWalker A49/51GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIQRVMMTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVITSCYPNEGKSDVAFQLAVEIGKMGKRVLIIDADIRKSSY
                                         TSCYPNEGKSDVAFQLAVEIGKMGKRVLIIDADIRKSSY
                                                GKS                 LIIDADIR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKRYQIKQKTNGLSQYLSGQVALEEVIYSTNYRNLEIIFSGPYAPNPSELLEQGRFSRLIEETRKAYDYVLIDTPPIINM
IKRYQIKQKTNGLSQYLSGQVALEEVIYSTNYRNLEIIFSGPYAPNPSELLEQGRFSRLIEETRKAYDYVLIDTPPIINM
                                                                     VLIDTPP    
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
SDAAIVAKQCDGAILVIESEAVSRRDAMKAKDQLTKSGCKLLGAVLNKVDMKKEKYYSKYNSYYYGKSKQE
SDAAIVAKQCDGAILVIESEAVSRRDAMKAKDQLTKSGCKLLGAVLNKVDMKKEKYYSKYNSYYYGKSKQE
                                                       YYSKYNSYYY      
© 1998-2019