BYKdb

Annotate results for A0A174YNA0

A0A174YNA0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174YNA0
DOMAINcd39/231TSSTPSEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNRGKKGKIKYGLTHYLSGKN
ELKDVICVSDVPNFCMIFAGPVPPNPSELVGNDRFVKMVEEARATFDMIIIDTPPIGSVI
DAAVISKVCDGGILVIGAGDISYKFARKSKEQLEMTGCKLLGCVLNKVDMTGNSYYGKYY
GKYYGKYYGKYYG
SITEWalker A46/48GKS
SITEWalker A'66/73LLIDADTR
SITEWalker B147/153IIIDTPP
SITE-88/-93YGLTHY
SITEY Cluster213/230YYGKYYGKYYGKYYGKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQEFSVKQSNLDFRTREAYKMLRTNIEFSGDNNKVIFITSSTPSEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNR
                                      TSSTPSEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNR
                                             GKS                 LLIDADTR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKKGKIKYGLTHYLSGKNELKDVICVSDVPNFCMIFAGPVPPNPSELVGNDRFVKMVEEARATFDMIIIDTPPIGSVIDA
GKKGKIKYGLTHYLSGKNELKDVICVSDVPNFCMIFAGPVPPNPSELVGNDRFVKMVEEARATFDMIIIDTPPIGSVIDA
                                                                  IIIDTPP       
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
AVISKVCDGGILVIGAGDISYKFARKSKEQLEMTGCKLLGCVLNKVDMTGNSYYGKYYGKYYGKYYGKYYGHEDNN
AVISKVCDGGILVIGAGDISYKFARKSKEQLEMTGCKLLGCVLNKVDMTGNSYYGKYYGKYYGKYYGKYYG     
                                                    YYGKYYGKYYGKYYGKYY      
© 1998-2019