BYKdb

Annotate results for A0A174Z985

A0A174Z985 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A174Z985
DOMAINcd42/230TSCYPNEGKSDVTFQLAVEIGKMGKKVLIIDADIRKSNYVKRFQVEQKVDGLSQYLSGQV
NKEKILYSTNYSNVDFIFAGPYAPNPSELLEQELFSKLIEETRKGYDYVLIDTPPMLSMS
DASIVAKQCDGAILVIQNEAVSRKDALRAKDQLKKSGCKLLGAVLNKVDMKKEKYYNKYN
SYYYYGSKE
SITEWalker A49/51GKS
SITEWalker A'69/76LIIDADIR
SITEWalker B150/156VLIDTPP
SITE-108/-149YSTNYSNVDFIFAGPYAPNPSELLEQELFSKLIEETRKGYDY
SITEY Cluster216/226YYNKYNSYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIQRVLMTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVITSCYPNEGKSDVTFQLAVEIGKMGKKVLIIDADIRKSNY
                                         TSCYPNEGKSDVTFQLAVEIGKMGKKVLIIDADIRKSNY
                                                GKS                 LIIDADIR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKRFQVEQKVDGLSQYLSGQVNKEKILYSTNYSNVDFIFAGPYAPNPSELLEQELFSKLIEETRKGYDYVLIDTPPMLSM
VKRFQVEQKVDGLSQYLSGQVNKEKILYSTNYSNVDFIFAGPYAPNPSELLEQELFSKLIEETRKGYDYVLIDTPPMLSM
                                                                     VLIDTPP    
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDASIVAKQCDGAILVIQNEAVSRKDALRAKDQLKKSGCKLLGAVLNKVDMKKEKYYNKYNSYYYYGSKE
SDASIVAKQCDGAILVIQNEAVSRKDALRAKDQLKKSGCKLLGAVLNKVDMKKEKYYNKYNSYYYYGSKE
                                                       YYNKYNSYYYY    
© 1998-2019