BYKdb

Annotate results for A0A175C561

A0A175C561 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A175C561
DOMAINcd63/252SSALPSEGKSTITANLAVACAQQGKKVLLVDADLRRPTVAVTFGITDNHGLTNYLADANS
DIQAIIHKTSMDKLDVVTSGPVPPNPAELLGSGRMTTLISELRAHYDLVIFDVPPFLMVT
DAQVLMSKMDGVAIVVSADKTTKGALQRTNDILKIAGSPVLGFIYNDMNRKKKGSAGYGY
GYGYGYGDTK
SITEWalker A70/72GKS
SITEWalker A'90/97LLVDADLR
SITEWalker B171/177VIFDVPP
SITEY Cluster240/248YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAFFRKRSQIGRDRLSTETMTKGARLITAAEPKNPVSEQFRTLRTNIEFASVAKGDVKTLLISSALPSEGKSTITANLAV
                                                              SSALPSEGKSTITANLAV
                                                                     GKS        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ACAQQGKKVLLVDADLRRPTVAVTFGITDNHGLTNYLADANSDIQAIIHKTSMDKLDVVTSGPVPPNPAELLGSGRMTTL
ACAQQGKKVLLVDADLRRPTVAVTFGITDNHGLTNYLADANSDIQAIIHKTSMDKLDVVTSGPVPPNPAELLGSGRMTTL
         LLVDADLR                                                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISELRAHYDLVIFDVPPFLMVTDAQVLMSKMDGVAIVVSADKTTKGALQRTNDILKIAGSPVLGFIYNDMNRKKKGSAGY
ISELRAHYDLVIFDVPPFLMVTDAQVLMSKMDGVAIVVSADKTTKGALQRTNDILKIAGSPVLGFIYNDMNRKKKGSAGY
          VIFDVPP                                                              Y
       250    
....:....|....
GYGYGYGYGDTKAK
GYGYGYGYGDTK  
GYGYGYGY      
© 1998-2019