BYKdb

Annotate results for A0A175M618

A0A175M618 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A175M618
DOMAINcd43/230TSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPNVHKLFKLSNTRGLSNLLIEDNG
IDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVVTD
AQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNY
YYEEDEKK
SITEWalker A50/52GKS
SITEWalker A'70/77ILVDCDLR
SITEWalker B150/156IILDTPP
SITE-147/-149YDY
SITEY Cluster217/224YRYYNYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDRNLNLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
                                          TSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
                                                 GKS                 ILVDCDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
                                                                     IILDTPP    
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNYYYEEDEKKKKRSKK
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNYYYEEDEKK      
                                                        YRYYNYYY            
© 1998-2019