BYKdb

Annotate results for A0A175RKC2

A0A175RKC2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A175RKC2
DOMAINtad1/184MIDFERILAIARRQYRLVLAGALGGLVLGMLYVLTAVPVYTASADIFIDKGAPQVMSEYS
EPTALLQDEVQMLSQVEVLKSTNLAEAVARRLKLDQNEAFMSASPSLVGRLVGGVKSLIA
FVPSLFWSPEIDDTNETDRIAAAAAILARNVAVERVGRTYVLSISYKAGTPVLAQQIAQG
YAEA
DOMAINcd546/738VSCLPSEGKSTTASNLAMLLSTPERRTLLIDADLRNPGLTRSLAVRPQTGLIEALLDGNG
DAKPHLLWDASGQLAVLPAVMRQRVSHSSELLSSASMGALMNAVRPHFHYVLVDLPPLGA
IVDAKAFAHRVDAFVFVVEWGRTARHVVRSILRDNPSVRAKCLGIILTKSDSSKMKLYRA
YGSSEFYASRYEA
SITEWalker A553/555GKS
SITEWalker A'573/580LLIDADLR
SITEWalker B656/662VLVDLPP
SITEY Cluster723/740YRAYGSSEFYASRYEAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIDFERILAIARRQYRLVLAGALGGLVLGMLYVLTAVPVYTASADIFIDKGAPQVMSEYSEPTALLQDEVQMLSQVEVLK
MIDFERILAIARRQYRLVLAGALGGLVLGMLYVLTAVPVYTASADIFIDKGAPQVMSEYSEPTALLQDEVQMLSQVEVLK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STNLAEAVARRLKLDQNEAFMSASPSLVGRLVGGVKSLIAFVPSLFWSPEIDDTNETDRIAAAAAILARNVAVERVGRTY
STNLAEAVARRLKLDQNEAFMSASPSLVGRLVGGVKSLIAFVPSLFWSPEIDDTNETDRIAAAAAILARNVAVERVGRTY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLSISYKAGTPVLAQQIAQGYAEAYLDDQLEAKYDATKRAGSWLQDRIAELQKQSFDADLAVEKFRTENNLIATNGQLVS
VLSISYKAGTPVLAQQIAQGYAEA                                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQQLTGVSAQLVTAKAETAQAKARYDQIRQLIDSGRTDAVVNDALVSSTINNLREQYLSASRREAEISAKLGSTHIQAVR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRDQMAEYERLIFAELGRIADSYQNAYKVALSREQSLEANLTQSLAVSADANTTQVRLRELERQAEAFKTLYESFLKRYQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETIQQQSFPVTQARIITRAEAPTAPSAPKKPLMLALFMMLGVGAGAGAGAWREFRDRFFRVADQIGRETGLEFLGYLPLV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPGEGDVGKATAAAPLMAGTGLWAPGAIAAYGRDHPMSSFAETLRNTRIAADVSLANETTKVIGVVSCLPSEGKSTTASN
                                                                 VSCLPSEGKSTTASN
                                                                        GKS     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAMLLSTPERRTLLIDADLRNPGLTRSLAVRPQTGLIEALLDGNGDAKPHLLWDASGQLAVLPAVMRQRVSHSSELLSSA
LAMLLSTPERRTLLIDADLRNPGLTRSLAVRPQTGLIEALLDGNGDAKPHLLWDASGQLAVLPAVMRQRVSHSSELLSSA
            LLIDADLR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMGALMNAVRPHFHYVLVDLPPLGAIVDAKAFAHRVDAFVFVVEWGRTARHVVRSILRDNPSVRAKCLGIILTKSDSSKM
SMGALMNAVRPHFHYVLVDLPPLGAIVDAKAFAHRVDAFVFVVEWGRTARHVVRSILRDNPSVRAKCLGIILTKSDSSKM
               VLVDLPP                                                          
       730       740  
....:....|....:....|..
KLYRAYGSSEFYASRYEAYYQN
KLYRAYGSSEFYASRYEA    
  YRAYGSSEFYASRYEAYY  

© 1998-2019