BYKdb

Annotate results for A0A175RVA6

A0A175RVA6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A175RVA6
DOMAINtad3/178PTELLFQIWGTARRHLVLIGAVTGAFLALAILYLMTAAPQFTATAVMVMDARKSTTMMNP
SAANQTETPLDNPTVESQLEILRSENIAFAVVRKLKLDEDPDLTRPSGFGALKGALRSWI
SAPTPPTPEQKLRAAAALVDNNLSVRRVGVTFVFEITFTANDPVRAAEIANAVADA
DOMAINcd520/708LSALPGEGKSTLAANFAELAAQSGARALLVDGDFRNPSLTRRLAGTARLPFSDLIGGRAA
QALVKTRDRRLDFLPAVRLEEGTSSNDVLSSPAMAGLLAELKRHYDYVVVDLPPLLPIID
ARASAEMIDSFVFTVEWGGTLADNARRALELSDRIQRKTVGIVLNKVDGRAAKRYFEYEY
APGKSAYYG
SITEWalker A527/529GKS
SITEWalker A'547/554LLVDGDFR
SITEWalker B627/633VVVDLPP
SITE-624/-626YDY
SITE-702/-704GKS
SITEY Cluster694/707YFEYEYAPGKSAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSPTELLFQIWGTARRHLVLIGAVTGAFLALAILYLMTAAPQFTATAVMVMDARKSTTMMNPSAANQTETPLDNPTVESQ
  PTELLFQIWGTARRHLVLIGAVTGAFLALAILYLMTAAPQFTATAVMVMDARKSTTMMNPSAANQTETPLDNPTVESQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEILRSENIAFAVVRKLKLDEDPDLTRPSGFGALKGALRSWISAPTPPTPEQKLRAAAALVDNNLSVRRVGVTFVFEITF
LEILRSENIAFAVVRKLKLDEDPDLTRPSGFGALKGALRSWISAPTPPTPEQKLRAAAALVDNNLSVRRVGVTFVFEITF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TANDPVRAAEIANAVADAYVTDQLDAKYQSTRRAGVWMQERLAELGAQATDAERAVVDFRARNNIVDAGGGRLLSEQQLT
TANDPVRAAEIANAVADA                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELSTQLSGARGTASEARARLDRVEQVLASDLSDWTLTDALRNEVIIKLRNQYSEVTKREADLIKRLGSQHQAVTNVRNEL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEVKRSIDEELKRIGEGYRSDYEIARARVETIETNLKEAVAEAQLSGQAQVQLRALESSAQSYRALYDSFLQRYRETVQQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSFPLTEARLITSASPPSQKSKPRASMTLAGALVMGALCGFGLAFLRDATDKTLRRPADVERQLGFACLANVPSLEGPEA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GMLREVVAHPISRFAEAIRAIKLAVDDHPPERGPQIVGFLSALPGEGKSTLAANFAELAAQSGARALLVDGDFRNPSLTR
                                       LSALPGEGKSTLAANFAELAAQSGARALLVDGDFRNPSLTR
                                              GKS                 LLVDGDFR      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLAGTARLPFSDLIGGRAAQALVKTRDRRLDFLPAVRLEEGTSSNDVLSSPAMAGLLAELKRHYDYVVVDLPPLLPIIDA
RLAGTARLPFSDLIGGRAAQALVKTRDRRLDFLPAVRLEEGTSSNDVLSSPAMAGLLAELKRHYDYVVVDLPPLLPIIDA
                                                                  VVVDLPP       
       650       660       670       680       690       700        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
RASAEMIDSFVFTVEWGGTLADNARRALELSDRIQRKTVGIVLNKVDGRAAKRYFEYEYAPGKSAYYG
RASAEMIDSFVFTVEWGGTLADNARRALELSDRIQRKTVGIVLNKVDGRAAKRYFEYEYAPGKSAYYG
                                                     YFEYEYAPGKSAYY 

© 1998-2019